Web Analysis for Lawtechseo - lawtechseo.com
2.90
Rating by CuteStat
lawtechseo.com is 6 years 10 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, lawtechseo.com is SAFE to browse.
PageSpeed Score
74
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | Not Applicable |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 9 |
Google Adsense: | Not Applicable | Google Analytics: | UA-32647203-1 |
Websites Hosted on Same IP (i.e. 184.175.95.2)
Family Law Attorney Services : Johnson Law
- familylawlawyerfayettevillenc.com
Johnson law practices family law in Wilmington, NC. We handle cases that consist of child custody to divorces.
Not Applicable
$
8.95
Armando Luna - Technology Consultant | websites, hosting, custom softw
- coolmando.com
Not Applicable
$
8.95
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Wed, 07 Jun 2017 02:48:49 GMT
Server: Apache
Last-Modified: Tue, 06 Jun 2017 18:15:46 GMT
ETag: "1ff9-5514e9bd031f7"
Accept-Ranges: bytes
Content-Length: 8185
Content-Type: text/html
Date: Wed, 07 Jun 2017 02:48:49 GMT
Server: Apache
Last-Modified: Tue, 06 Jun 2017 18:15:46 GMT
ETag: "1ff9-5514e9bd031f7"
Accept-Ranges: bytes
Content-Length: 8185
Content-Type: text/html
Domain Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
lawtechseo.com | A | 14388 |
IP: 184.175.95.2 |
lawtechseo.com | NS | 86399 |
Target: ns4.hostek.com |
lawtechseo.com | NS | 86399 |
Target: ns3.hostek.com |
lawtechseo.com | SOA | 86399 |
MNAME: ns3.hostek.com RNAME: cpanel.hostek.com Serial: 2017052904 Refresh: 3600 Retry: 7200 Expire: 1209600 Minimum TTL: 86400 |
lawtechseo.com | MX | 14399 |
Target: lawtechseo.com |
lawtechseo.com | TXT | 14399 |
TXT: v=spf1 +a +mx +ip4:184.175.95.2 ~all |